Enkephalin anticorps (Middle Region)

N° du produit ABIN634799

L’anticorps Lapin Polyclonal anti-Enkephalin a été validé pour WB. Il convient pour détecter Enkephalin dans des échantillons de Humain.

Aperçu rapide pour Enkephalin anticorps (Middle Region) (ABIN634799)

Antigène: Enkephalin (PENK) (Proenkephalin (PENK))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Enkephalin est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Enkephalin anticorps

Épitope: Middle Region

Specificité: PENK antibody was raised against the middle region of PENK

Purification: Affinity purified

Immunogène: PENK antibody was raised using the middle region of PENK corresponding to a region with amino acids DAEEDDSLANSSDLLKELLETGDNRERSHHQDGSDNEEEVSKRYGGFMRG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PENK Blocking Peptide, (ABIN937232), is also available for use as a blocking control in assays to test for specificity of this PENK antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PENK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Enkephalin

Antigène: Enkephalin (PENK) (Proenkephalin (PENK))

Autre désignation: PENK

Sujet: Met- and Leu-enkephalins compete with and mimic the effects of opiate drugs. They play a role in a number of physiologic functions, including pain perception and responses to stress.

Poids moléculaire: 31 kDa (MW of target protein)

Pathways: Stem Cell Maintenance